c-Met signaling is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Updated 2026-07-10. Numbers and descriptions here follow the published literature rather than marketing material.
Dihexa is a synthetic peptide derived from angiotensin IV, a naturally occurring fragment of the renin-angiotensin system. Researchers modified the angiotensin IV structure to improve metabolic stability and central nervous system activity. It is frequently described as a hepatocyte growth factor mimetic because it can activate the c-Met receptor pathway in experimental systems. Its development reflects interest in small peptides that influence synaptic plasticity and cognitive processes. Most information comes from preclinical studies rather than controlled human trials.
The compound has been examined in animal models for effects on learning, memory, and synaptic connectivity. Some reports describe increased dendritic spine density and improved performance on certain behavioral tasks after administration in rodents. These findings are often cited in discussions of nootropic research peptides, but replication across independent laboratories remains limited. The absence of published phase 1 or phase 2 clinical trial data makes it difficult to assess safety, effective routes, or long-term outcomes in humans. Consequently, claims about cognitive benefits in people remain speculative.
Laboratory characterization of dihexa typically relies on reverse-phase high-performance liquid chromatography for purity and mass spectrometry for identity. These methods are standard for synthetic peptides and help distinguish the target compound from related impurities or degradation products. Because dihexa is a small peptide-like molecule, it may be susceptible to hydrolysis under certain conditions. Storage recommendations generally emphasize low temperature, dryness, and protection from light. Analytical certificates from suppliers vary in detail, so independent verification can be important for research use.
Reported effects of dihexa are often described in terms of synaptogenesis, a process by which neurons form new synaptic connections. This concept is biologically plausible but difficult to measure directly in living humans. Animal behavioral tests can suggest memory or learning changes, yet such tests have limitations and may not translate to people. The literature includes conflicting or incomplete findings, and some studies are small. As a result, the mechanism remains a subject of investigation rather than a settled explanation.
| Property | Value | Notes |
|---|---|---|
| Chemical class | Synthetic peptide | Derived from angiotensin IV and modified for stability. |
| Proposed mechanism | c-Met/HGF pathway activation | Described as an HGF mimetic in experimental systems. |
| Common synonyms | Dihexa; N-hexanoic-Tyr-Ile-(6)-aminohexanoic amide | Name usage varies by supplier and publication. |
| Regulatory status | Not approved as a drug | Sold as a research chemical in some markets. |
| Human trial data | Limited or absent | Most evidence comes from preclinical studies. |
Analytical confirmation generally combines a separation method with a detection method. Reverse-phase high-performance liquid chromatography can assess purity, while mass spectrometry supports molecular identity. For research-grade material, a certificate of analysis may report a batch-specific purity value, but it does not guarantee biological activity or safety. Regulatory frameworks vary by country; many jurisdictions treat dihexa as a research chemical not intended for human consumption. Purchasers should verify local rules and supplier documentation. The absence of official standards makes independent testing and careful record-keeping important for laboratory work.
In laboratory settings, dihexa is typically handled as a research chemical rather than a pharmaceutical product. Suppliers may provide it as a lyophilized powder or in solution, and purity is often stated as a percentage determined by chromatographic analysis. Because independent verification is uncommon, researchers generally rely on certificates of analysis, which may include high-performance liquid chromatography and mass spectrometry data. The absence of pharmacopeial monographs means that identity, purity, and impurity profiles can vary between batches and suppliers.
Storage recommendations for peptides and peptide-like compounds usually emphasize low temperatures, desiccation, and protection from light. A common practice is to keep dry powder at -20 °C or below and to prepare solutions shortly before use. Repeated freeze-thaw cycles may degrade the material, so aliquoting is often advised. Solubility depends on the solvent; aqueous solubility may be limited, and organic solvents such as dimethyl sulfoxide are sometimes used for stock solutions. Stability data specific to dihexa are sparse, so general peptide handling guidelines are often applied instead.
Dihexa appears in scientific literature, patent documents, and commercial catalogs under several names, which can complicate searching and verification. The compound is frequently grouped with nootropics or research chemicals, terms that describe context of use rather than regulatory approval. Such labeling may imply benefits that have not been confirmed in controlled human studies. Readers encountering promotional descriptions should distinguish between preclinical observations and established medical facts. The absence of regulatory approval is a central feature of its current status.
Dihexa is a synthetic peptide-like compound studied in preclinical research for its reported effects on synaptic growth and cognitive measures in animal models. It is often described as an analog of angiotensin IV, a naturally occurring peptide fragment. The compound has not been approved as a medicine in any major jurisdiction. Most public information comes from laboratory studies, patents, and online vendor listings rather than from large clinical trials. Its scientific status therefore differs from that of an established pharmaceutical.
Automated iterative homologation enables stepwise construction of carbon chains through repeated one-carbon extensions of boronic esters. Two reactions adapted to automation are the Matteson homologation, which inserts a methylene unit via chloromethyllithium, and chiral carbenoid homologation, which uses lithiated benzoate esters. Both methods have been implemented on robotic platforms under low-temperature, inert conditions. Using these techniques, up to six consecutive C(sp³)–C(sp³) bond-forming homologations have been performed without manual intervention, representing the highest number reported in an automated synthesis. The approach has also been applied to the synthesis of intermediates of the natural product (+)-kalkitoxin.
The first generation uses linking technologies that conjugate drugs non-selectively to cysteine or lysine residues in the antibody, resulting in a heterogeneous mixture. This approach leads to suboptimal safety and efficacy and complicates optimization of the biological, physical and pharmacological properties. Site-specific incorporation of unnatural amino acids generates a site for controlled and stable attachment. This enables the production of homogeneous ADCs with the antibody precisely linked to the drug and controlled ratios of antibody to drug, allowing the selection of a best-in-class ADC. An Escherichia coli-based open cell-free synthesis (OCFS) allows the synthesis of proteins containing site-specifically incorporated non-natural amino acids and has been optimized for predictable high-yield protein synthesis and folding. The absence of a cell wall allows the addition of non-natural factors to the system to manipulate transcription, translation and folding to provide precise protein expression modulation.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
TNP refers to the chemical compound 2,4,6-trinitrophenol, also known as Picric acid. It is a primary constituent of many unexploded landmines, and is a cousin to TNT, but less stable. It is recognized as an environmental contaminant and is toxic to many organisms. It is still commonly used in the manufacturing of fireworks, explosives, and rocket fuels, as well as in leather, pharmaceutical, and dye industries. ATP is an essential mediator of life. It is used to overcome unfavorable energy barriers to initiate and fuel chemical reactions. It is also used to drive biological machinery and regulate a number of processes via protein-phosphorylation. However, the proteins that bind ATP for both regulation and enzymatic reactions are very diverse—many yet undiscovered—and for many proteins their relationship to ATP in terms of number of binding sites, binding constants, and dissociation constants remain unclear.
Sources: en.wikipedia.org
Pregnant women are advised to pay attention to the foods they eat during pregnancy to reduce the risk of exposure to substances or bacteria that may be harmful to the developing fetus. This can include potentially harmful pathogens such as listeria, toxoplasmosis, and salmonella. Intake of large amounts of retinol has been linked to birth defects and abnormalities. During pregnancy, a woman's mass increases by about 12 kg (26 lb). The European Food Safety Authority recommends an increase of 300 mL per day compared to the normal intake for non-pregnant women, taking the total adequate water intake (from food and fluids) to 2,300 mL, or approximately 1,850 mL/ day from fluids alone.
Actin-binding proteins (also known as ABPs) are proteins that bind to actin. This may mean ability to bind actin monomers, or polymers, or both. Many actin-binding proteins, including α-actinin, β-spectrin, dystrophin, utrophin and fimbrin, do this through the actin-binding calponin homology domain. This is a list of actin-binding proteins in alphabetical order. 25kDa 25kDa ABP from aorta 30akDA 30bkDa 34kDA 45kDa 110 kD dimer ABP 110 kD (Drebrin) p53 p58gag p185neu p116rip a-actinin Abl ABLIM Actin-Interacting MAPKKK Ssk2p ABP120 ABP140 Abp1p ABP280 (Filamin) ABP50 (EF-1a) Acan 125 (Carmil) ActA Actibind Actin Actinfilin Actinogelin Actin-regulating kinases Actin-Related Proteins Actobindin Actolinkin Actopaxin Actophorin Acumentin (= L-plastin) Adducin ADF/Cofilin Adseverin (scinderin) Afadin AFAP-110 Affixin Aginactin AIP1 Aldolase Angiogenin Anillin Annexins Aplyronine Archvillin (isoform of Supervillin) Arginine kinase Arp2/3 complex Band 4.1 Band 4.9 (Dematin) b-actinin b-Cap73 Bifocal Bistramide A BPAG1 Brevin (Gelsolin)
The protein encoded by the DLD gene comes together with another protein to form a dimer in the central metabolic pathway. Several amino acids within the catalytic pocket have been identified as important to DLD function, including R281 and N473. Although the overall fold of the human enzyme is similar to that of yeast, the human structure is different in that it has two loops that extend from the general protein structure and into the FAD binding sites when bound the NAD+ molecule, required for catalysis, is not close to the FAD moiety. However, when NADH is bound instead, it is stacked directly op top of the FAD central structure. The current hE3 structures show directly that the disease-causing mutations occur at three locations in the human enzyme: the dimer interface, the active site, and the FAD and NAD(+)-binding sites.
Atoltivimab/maftivimab/odesivimab, sold under the brand name INMAZEB, is a fixed-dose combination of three monoclonal antibodies for the treatment of ebola caused by Zaire ebolavirus. It was developed by Regeneron Pharmaceuticals and contains three human monoclonal antibodies, atoltivimab, maftivimab, and odesivimab-ebgn. The most common side effects include fever, chills, tachycardia (fast heart rate), tachypnea (fast breathing), and vomiting; however, these are also common symptoms of Ebola virus infection. Atoltivimab/maftivimab/odesivimab is the first FDA-approved treatment for Zaire ebolavirus. Atoltivimab/maftivimab/odesivimab was approved for medical use in the United States in October 2020. The U.S. Food and Drug Administration (FDA) considers it to be a first-in-class medication. It is on the World Health Organization's List of Essential Medicines. Atoltivimab/maftivimab/odesivimab is indicated for the treatment of infection caused by Zaire ebolavirus.
Luis Moroder grew up in the small ethnic community of Ladins in the Dolomites of South Tyrol in Northern Italy. As a boy he became fascinated by natural science while accompanying his father Heinrich on mineralogical, paleontological and archaeological excursions in the mountain world of his homeland with discoveries of various fossiles that are exemplary shown in the Museum Gherdeina. Moroder was married to Anne Marie Hellrigl-Moroder with one daughter. He died on 18 May 2024, at the age of 83. 1995: Max-Bergmann-Medal of the MBK Society 2004: Josef Rudinger Award of the European Peptide Society 2011: Doctor honoris causa, University of Cergy-Pontoise, Paris 2018: Akabori Memorial Lecture Award of the Japanese Peptide Society 2020: Ernesto Scoffone Award of the Italian Peptide Society
Sources: en.wikipedia.org
Dihexa is a synthetic peptide derived from angiotensin IV and studied for effects on synaptic plasticity. It is often described as a hepatocyte growth factor mimetic. It is not an approved medication.
It is based on angiotensin IV, a naturally occurring peptide fragment, but dihexa itself is chemically modified and synthetic. The modifications aim to improve stability and activity compared with the parent fragment.
Laboratory studies have used cell-based assays and rodent models. These examine receptor signaling, dendritic spine changes, and behavioral tasks. Published human clinical trial data are lacking.
Dihexa has been reported to activate hepatocyte growth factor/c-Met signaling in cell studies. This pathway is linked to synapse formation and neuronal remodeling. The exact molecular interactions are not fully understood.